BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0951 (673 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 25 1.6 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 8.8 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 25.4 bits (53), Expect = 1.6 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 412 LICLKFCKFFLRINILISLGGIKITKIYINL 320 L ++FC + R+++++ I IYINL Sbjct: 24 LYSMRFCPYAQRVHLMLDAKKIPYHAIYINL 54 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 23.0 bits (47), Expect = 8.8 Identities = 6/22 (27%), Positives = 13/22 (59%) Frame = +2 Query: 74 LIFVWNAIVCVRLPLGALFQLH 139 ++ +W+ + V +P G +LH Sbjct: 214 IVLIWSFAIMVTMPYGLYMKLH 235 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 595,241 Number of Sequences: 2352 Number of extensions: 10558 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -