BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0951 (673 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92833-2|CAB07379.1| 891|Caenorhabditis elegans Hypothetical pr... 28 6.9 U41992-9|AAK93854.1| 294|Caenorhabditis elegans Hypothetical pr... 27 9.2 >Z92833-2|CAB07379.1| 891|Caenorhabditis elegans Hypothetical protein F38A6.2 protein. Length = 891 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = -1 Query: 235 KKIRVQTSGHRPVCLGASFLTLSIA*QLTQFSMQLEQRP*RQTYANDRIPY 83 + + +Q P C G S L I+ + ++M P R ++AN + Y Sbjct: 71 QNLEIQDQSRSPTCSGYSSLPRRISGSKSSYTMSPSHAPPRSSHANSKSLY 121 >U41992-9|AAK93854.1| 294|Caenorhabditis elegans Hypothetical protein F32E10.7 protein. Length = 294 Score = 27.5 bits (58), Expect = 9.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 436 RYQRLNFQITCWSNTLDYVNATIF 507 R+Q++ +T W N+LDY IF Sbjct: 162 RFQKMKSHLTTWFNSLDYDGEYIF 185 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,061,307 Number of Sequences: 27780 Number of extensions: 243824 Number of successful extensions: 399 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 399 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -