BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0949 (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) 75 4e-14 SB_21942| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.053) 32 0.51 SB_6123| Best HMM Match : MutS_III (HMM E-Value=1.8e-09) 31 1.2 SB_57196| Best HMM Match : ADAM_spacer1 (HMM E-Value=3.1e-31) 29 2.7 SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_56325| Best HMM Match : Ribosomal_L14e (HMM E-Value=0.84) 29 3.6 SB_40410| Best HMM Match : ANF_receptor (HMM E-Value=0) 29 3.6 SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 29 3.6 SB_34369| Best HMM Match : Herpes_US9 (HMM E-Value=0.64) 29 3.6 SB_40908| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_45389| Best HMM Match : Peptidase_M13 (HMM E-Value=4.1e-09) 29 4.7 SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_4321| Best HMM Match : Ank (HMM E-Value=0) 28 6.2 SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) 28 8.3 SB_9876| Best HMM Match : TSNR_N (HMM E-Value=7.6) 28 8.3 >SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) Length = 50 Score = 75.4 bits (177), Expect = 4e-14 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 371 MRGAFGKPQGTVARVRIGQPIMSVRSSDRWKAQVIEALRRAKFKFP 508 MRGAFGKPQGTVARV IGQ I+S+R+ D KA IEALRRAKFKFP Sbjct: 1 MRGAFGKPQGTVARVNIGQTIISIRTKDGNKAAAIEALRRAKFKFP 46 >SB_21942| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.053) Length = 659 Score = 31.9 bits (69), Expect = 0.51 Identities = 25/79 (31%), Positives = 35/79 (44%) Frame = -1 Query: 643 EVHVPGGTAQCSRH*RGGPLHAASQTHHVHTL*NPTSLIRRSFDVGELELGTAQSLDDLC 464 ++HV G + + H GG L Q H + NP++ + LE TA + Sbjct: 12 QLHVRGLSRKWVMH-PGGRLPVKRQLHLISAPVNPSTRFTPTLSRMSLETVTAAPIPTQT 70 Query: 463 LPPVTRAHGHDGLSNANTC 407 V A+ DGLSNAN C Sbjct: 71 SRSVALAY--DGLSNANVC 87 >SB_6123| Best HMM Match : MutS_III (HMM E-Value=1.8e-09) Length = 730 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -1 Query: 328 IDADNVERVNSHADMELILSAVLYEYLLQQIRPASKASELSCSYSSDTK 182 + A+ V+R+ SH M+ + S + Y +PA+K + L C Y+ K Sbjct: 16 LTAERVQRLLSHTRMKEV-SRICKVYFSSDTKPAAKTNNLLCQYNEIKK 63 >SB_57196| Best HMM Match : ADAM_spacer1 (HMM E-Value=3.1e-31) Length = 718 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 34 GAGQRDATGTAKINRIRNRGSVGVYLIPRSVSSIWVRRERPLTTF 168 G G T N++ +G V LIP+ +I VR +P T+F Sbjct: 313 GNGTACYTVEGSFNQLAGKGYVEAALIPKGARNIRVREVKPCTSF 357 >SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 225 PKPLSSAVHIRRTPSARTVESRQRSLSSYPNRRYGSWDQ 109 PK SS V+ RT AR ++R++ Y ++YG W Q Sbjct: 295 PKFFSSIVYYGRT--ARFDYGKRRNMKRYGKKKYGKWRQ 331 >SB_56325| Best HMM Match : Ribosomal_L14e (HMM E-Value=0.84) Length = 650 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -1 Query: 253 YLLQQIRPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 122 Y+++QI+ ASK L + T C + K S V F+ K K R Sbjct: 252 YIVKQIQVASKVKVLKAKLENQTLCQQT-KRSKVTDFISKQKSR 294 >SB_40410| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 888 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 469 GHRGSAPCQVQVPRRQKIYVSKKWGFTKYERDEF 570 G +G PC QV + +Y K GF Y+ D F Sbjct: 368 GAKGFEPCGPQVKITKPLYERLKSGFVTYQEDAF 401 >SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) Length = 1273 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -1 Query: 253 YLLQQIRPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 122 Y+++QI+ ASK L + T C + K S V F+ K K R Sbjct: 1020 YIVKQIQVASKVKVLKAKLENQTLCQQT-KRSKVTDFISKQKSR 1062 >SB_34369| Best HMM Match : Herpes_US9 (HMM E-Value=0.64) Length = 361 Score = 29.1 bits (62), Expect = 3.6 Identities = 41/164 (25%), Positives = 65/164 (39%), Gaps = 2/164 (1%) Frame = -1 Query: 637 HVPGGTAQCSRH*RGGPLHAASQTHHVHTL*NPTSLIRRSFDVGELELGTAQSLDDLCLP 458 H+P G +H P+HA S + N +++ GE L + + Sbjct: 18 HLPSGNRLLVQHPPAFPIHAQSYLTRRRAVFNTMAVLHTVLTKGEQTLFFERPIRRPRFV 77 Query: 457 PVTRAHGHDGLSNANTCYSTLRLAKRTTHPSLEPISSSA**HFIDADNVERVNSHADMEL 278 + + S N+ Y+ R + TT +L PI++ H VE +N A+ E Sbjct: 78 ALRQC------SLFNSWYNLEREHQITTIAALPPIATLPAGHQTAESIVETIN-RAESE- 129 Query: 277 ILSAVL--YEYLLQQIRPASKASELSCSYSSDTKCTHSGKSSTV 152 IL+A L E Q P +A + C T+C G+ S V Sbjct: 130 ILTAKLDPREDRAQVALPKIEALYICCDIVDRTQCLSLGEPSNV 173 >SB_40908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 28.7 bits (61), Expect = 4.7 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = +2 Query: 476 EALRRAKFKFPDVKRSTYQRSGVSQSMNVMSLRSCVKRAASLMTAALCSTARNMDLFDAW 655 +++ A K D + + S + + LR VKR ++TA C+ + L DAW Sbjct: 126 DSVFNALVKVLDTELYPQAEADKSSTYGLKELRLLVKRFQEILTANGCNVMKIEKLKDAW 185 Query: 656 RKV 664 K+ Sbjct: 186 AKL 188 >SB_45389| Best HMM Match : Peptidase_M13 (HMM E-Value=4.1e-09) Length = 177 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 260 KNCGKDQFHIRMRIHPFHVIRINKMLS 340 KN +D +RM +HP H IRIN ++S Sbjct: 127 KNAAEDI--VRMSVHPLHPIRINGVVS 151 >SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1278 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -1 Query: 520 SFDVGELELGTAQSLDDLCLPPVTRAHGHDGLSNANT--CYSTLRLAKRTT 374 S G + T D+C+P + HGH +ANT CY + A +T Sbjct: 71 SCSAGHYVVRTGNPFTDICIP--CQCHGHSDQCDANTGICYVRIYTADLST 119 >SB_4321| Best HMM Match : Ank (HMM E-Value=0) Length = 915 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +3 Query: 57 RYCKNKPYPKSRFCRGVPDPKIRIFDLGKKRATVDDFPLCVHLVSDEYEQLSSEALEAGR 236 R CK K ++R C+G + R+ K D+ +C SDE E + R Sbjct: 444 RMCKGKGRDETRMCKGEGTDETRMC----KSEGTDETRMCKDEGSDETRMCKDEGTDETR 499 Query: 237 IC 242 +C Sbjct: 500 MC 501 >SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) Length = 726 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 Query: 379 CVWQASGYCSTCSHWTAHHV 438 C W +G C C HW HV Sbjct: 79 CYWIRTGCCHLCWHWRPLHV 98 >SB_9876| Best HMM Match : TSNR_N (HMM E-Value=7.6) Length = 197 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/46 (39%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -1 Query: 541 PTSLIRRSFDVGELE-LGTAQSLDDLCLPPVTRAHGHDGLSNANTC 407 P SL R V +E LG L +PPV R H G+ N +TC Sbjct: 102 PPSLKVRRATVASIESLGEGHRKGSLFMPPVQRGKKH-GVINIHTC 146 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,808,220 Number of Sequences: 59808 Number of extensions: 564689 Number of successful extensions: 2003 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2001 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -