BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0948 (696 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 24 4.0 EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. 23 7.0 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 24.2 bits (50), Expect = 4.0 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +1 Query: 469 VQTKKNCDRKHSTRRDESLIEVYVSSWEFDPYLNMEENAYLFAEI 603 + KK+ + K RRD+ + + D L EEN L A++ Sbjct: 79 IMMKKSRETKEEARRDKEKAIRHREEYRRDMALIREENTKLLAQL 123 >EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. Length = 213 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 599 KLVLLGISSFKKIILMLHFVR 661 KLVLLG S+ K L+L FV+ Sbjct: 26 KLVLLGESAVGKSSLVLRFVK 46 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 686,405 Number of Sequences: 2352 Number of extensions: 12672 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -