BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0947 (639 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31804| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_56355| Best HMM Match : U-box (HMM E-Value=0.00021) 28 5.6 SB_57704| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_31804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2047 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = -2 Query: 431 HKYKEKNFVIS*PFLRNTCRNVNLKLKKYKPTPSMPLYKII*KKHGPDNEYTFV 270 H Y +++F R + + + + Y+P P L+KI+ G D EY FV Sbjct: 690 HAYFKRHFTNE--EFREVRKILEILIATYEPLPVKELFKILQNSDGLDYEYDFV 741 >SB_56355| Best HMM Match : U-box (HMM E-Value=0.00021) Length = 191 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +1 Query: 403 ITKFFSLYLCSLLNSLVKIVISKFVLNLVPFWFWTISNVFCFFLLFYLVMCFI 561 IT F L L+ ++++V+ FVL LVP + +F L +V+CF+ Sbjct: 124 ITVFQKHSLVQRLDEVIQVVLG-FVLFLVPKLAHAFNGIFDGHLSLVVVLCFV 175 >SB_57704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/50 (24%), Positives = 27/50 (54%) Frame = +1 Query: 448 LVKIVISKFVLNLVPFWFWTISNVFCFFLLFYLVMCFINI*NLIYIICEV 597 ++ I+I ++ ++ + + F++ +V CFIN IY+IC++ Sbjct: 13 IIIIIIIIIIIIIIVIIIVIVVVIIIIFIVVVVVFCFIN----IYVICDI 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,559,562 Number of Sequences: 59808 Number of extensions: 290326 Number of successful extensions: 570 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -