BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0945 (643 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CU457743-1|CAM36364.1| 692|Caenorhabditis elegans Hypothetical ... 29 3.7 CU457743-2|CAM36365.1| 695|Caenorhabditis elegans Hypothetical ... 27 8.6 >CU457743-1|CAM36364.1| 692|Caenorhabditis elegans Hypothetical protein K09E10.1 protein. Length = 692 Score = 28.7 bits (61), Expect = 3.7 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 305 YGLRVMLDR-CLKRC*VGMSFCQYIVQNIYVLTIHFRKSLSKNHKKIYLSK 454 Y L M++R C+KR S+C + N F S +KNH K+++ + Sbjct: 443 YDLETMIERGCVKRSPNHPSWCDFKFLNGKFNIAIFGNSYAKNHHKMFIQE 493 >CU457743-2|CAM36365.1| 695|Caenorhabditis elegans Hypothetical protein K09E10.2 protein. Length = 695 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 305 YGLRVMLDR-CLKRC*VGMSFCQYIVQNIYVLTIHFRKSLSKNHKKIYLSK 454 Y + VM++ C+KR +C Y ++ F S +KNH K+++ + Sbjct: 441 YDIEVMIEPGCVKRTPQHSRWCDYELKGDEFKLAIFGNSYTKNHHKMFIQE 491 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,773,438 Number of Sequences: 27780 Number of extensions: 161951 Number of successful extensions: 279 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 279 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -