BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0943 (694 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26242| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.8e-15) 31 1.2 SB_42588| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 >SB_26242| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.8e-15) Length = 1019 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -1 Query: 661 LPWSLTYFKFRHRHSLLQFER-*TMTDVKTK 572 LPW++++ KFR +HSLL R + DVK K Sbjct: 275 LPWAISHGKFRDKHSLLHTLRDNSSNDVKEK 305 >SB_42588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 256 EFEEDRADGAKVKSVCTFEGNTLK 327 E E+D DG+K S CTFEG T++ Sbjct: 27 EHEKDLRDGSKRISGCTFEGITMQ 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,446,982 Number of Sequences: 59808 Number of extensions: 325907 Number of successful extensions: 785 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -