BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0942 (563 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC125202-1|AAI25203.1| 514|Homo sapiens cytidine and dCMP deami... 31 2.1 BC092434-1|AAH92434.1| 251|Homo sapiens CDADC1 protein protein. 31 2.1 BC070238-1|AAH70238.1| 251|Homo sapiens CDADC1 protein protein. 31 2.1 BC032889-1|AAH32889.1| 153|Homo sapiens CDADC1 protein protein. 31 2.1 BC009562-1|AAH09562.1| 99|Homo sapiens CDADC1 protein protein. 31 2.1 AY027525-1|AAK16745.1| 514|Homo sapiens protein kinase NYD-SP15... 31 2.1 AL138875-2|CAI10891.1| 96|Homo sapiens cytidine and dCMP deami... 31 2.1 AL138875-1|CAI10890.2| 514|Homo sapiens cytidine and dCMP deami... 31 2.1 >BC125202-1|AAI25203.1| 514|Homo sapiens cytidine and dCMP deaminase domain containing 1 protein. Length = 514 Score = 31.5 bits (68), Expect = 2.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 451 SDQNRAFRSRVPRLESLNLFTCLSLIIILTPGE 549 S Q + ++PRL +NLFT LSL + L P E Sbjct: 20 STQTGSMTGQIPRLSKVNLFTLLSLWMELFPAE 52 >BC092434-1|AAH92434.1| 251|Homo sapiens CDADC1 protein protein. Length = 251 Score = 31.5 bits (68), Expect = 2.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 451 SDQNRAFRSRVPRLESLNLFTCLSLIIILTPGE 549 S Q + ++PRL +NLFT LSL + L P E Sbjct: 20 STQTGSMTGQIPRLSKVNLFTLLSLWMELFPAE 52 >BC070238-1|AAH70238.1| 251|Homo sapiens CDADC1 protein protein. Length = 251 Score = 31.5 bits (68), Expect = 2.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 451 SDQNRAFRSRVPRLESLNLFTCLSLIIILTPGE 549 S Q + ++PRL +NLFT LSL + L P E Sbjct: 20 STQTGSMTGQIPRLSKVNLFTLLSLWMELFPAE 52 >BC032889-1|AAH32889.1| 153|Homo sapiens CDADC1 protein protein. Length = 153 Score = 31.5 bits (68), Expect = 2.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 451 SDQNRAFRSRVPRLESLNLFTCLSLIIILTPGE 549 S Q + ++PRL +NLFT LSL + L P E Sbjct: 20 STQTGSMTGQIPRLSKVNLFTLLSLWMELFPAE 52 >BC009562-1|AAH09562.1| 99|Homo sapiens CDADC1 protein protein. Length = 99 Score = 31.5 bits (68), Expect = 2.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 451 SDQNRAFRSRVPRLESLNLFTCLSLIIILTPGE 549 S Q + ++PRL +NLFT LSL + L P E Sbjct: 20 STQTGSMTGQIPRLSKVNLFTLLSLWMELFPAE 52 >AY027525-1|AAK16745.1| 514|Homo sapiens protein kinase NYD-SP15 protein. Length = 514 Score = 31.5 bits (68), Expect = 2.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 451 SDQNRAFRSRVPRLESLNLFTCLSLIIILTPGE 549 S Q + ++PRL +NLFT LSL + L P E Sbjct: 20 STQTGSMTGQIPRLSKVNLFTLLSLWMELFPAE 52 >AL138875-2|CAI10891.1| 96|Homo sapiens cytidine and dCMP deaminase domain containing 1 protein. Length = 96 Score = 31.5 bits (68), Expect = 2.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 451 SDQNRAFRSRVPRLESLNLFTCLSLIIILTPGE 549 S Q + ++PRL +NLFT LSL + L P E Sbjct: 16 STQTGSMTGQIPRLSKVNLFTLLSLWMELFPAE 48 >AL138875-1|CAI10890.2| 514|Homo sapiens cytidine and dCMP deaminase domain containing 1 protein. Length = 514 Score = 31.5 bits (68), Expect = 2.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 451 SDQNRAFRSRVPRLESLNLFTCLSLIIILTPGE 549 S Q + ++PRL +NLFT LSL + L P E Sbjct: 20 STQTGSMTGQIPRLSKVNLFTLLSLWMELFPAE 52 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,252,655 Number of Sequences: 237096 Number of extensions: 526991 Number of successful extensions: 367 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 367 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5703349406 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -