BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0941 (693 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 2.3 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 25.0 bits (52), Expect = 2.3 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 2/63 (3%) Frame = +1 Query: 295 YFVFKQ*FRFYIYFLLLV*RTKT*VMNVGLG--VPNSVLSAPNLVLTEKNSKEFIVNLSS 468 +FV Q F + I+ L+++ T T M + VL NL+ T + EF+ L++ Sbjct: 1170 WFVTSQPFEYMIFVLIMI-NTITLSMKFYRQPEIYTEVLDLLNLIFTAVFALEFVFKLAA 1228 Query: 469 FSY 477 F + Sbjct: 1229 FRF 1231 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 694,682 Number of Sequences: 2352 Number of extensions: 13552 Number of successful extensions: 59 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -