BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0937 (656 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0013 - 217743-217839,218021-218131,218226-218428,218540-21... 28 7.5 >04_01_0013 - 217743-217839,218021-218131,218226-218428,218540-218654, 219038-219204,219505-219565,219872-219990,220206-220286 Length = 317 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -2 Query: 244 IAVFVIGIMVI*SPNRELPFPKYWALSTLWLGLYV 140 +A F++G+ + PN ELP +W + W+ +V Sbjct: 154 LAGFLVGLKQL-LPNLELPMCFFWKIKAKWMPFFV 187 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,651,042 Number of Sequences: 37544 Number of extensions: 229620 Number of successful extensions: 384 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -