BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0936 (692 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 3.6 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 3.6 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 21 8.4 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.4 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.6 bits (46), Expect = 3.6 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -1 Query: 434 TLLDVCTLHACYLNVYFIHLYIGFFIFLLLRWV 336 T L+V + L Y H YI + +++ WV Sbjct: 232 TCLEVVFVLKRRLGYYLFHTYIPTCLIVIMSWV 264 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 102 VVIYW*SFCTSCIYNDXXLRAFV 34 VV W FC+ CI+ + + A V Sbjct: 353 VVNLWSGFCSQCIWQEKIVFAAV 375 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -3 Query: 132 CKLTLYSFVRVVIYW*SFCTSCI 64 C+ ++ V V++W +C S I Sbjct: 35 CRNCIHPTVFSVLFWLGYCNSAI 57 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -3 Query: 132 CKLTLYSFVRVVIYW*SFCTSCI 64 C+ ++ V V++W +C S I Sbjct: 483 CRNCIHPTVFSVLFWLGYCNSAI 505 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,835 Number of Sequences: 438 Number of extensions: 3036 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -