BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0935 (639 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 27 0.100 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 23 2.1 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 23 2.8 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 23 2.8 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 27.5 bits (58), Expect = 0.100 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -1 Query: 117 NANIFYKLCIYNYTHYLYLIHTLKYLYSLFIV 22 N ++ + LC+ +T +L + + Y YS FI+ Sbjct: 190 NMHLLFLLCLDYFTLHLLFLPCIYYFYSAFII 221 Score = 25.4 bits (53), Expect = 0.40 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -1 Query: 111 NIFYKLCIYNYTHYLYLIHTLKYLYSLFIV 22 ++ + LCIY + L+ + + Y Y FI+ Sbjct: 126 HLLFLLCIYYFVVPLFFLLCIYYFYCAFII 155 Score = 21.4 bits (43), Expect = 6.6 Identities = 7/29 (24%), Positives = 15/29 (51%) Frame = -1 Query: 108 IFYKLCIYNYTHYLYLIHTLKYLYSLFIV 22 + + LC Y + + ++ + Y Y FI+ Sbjct: 94 VHFLLCTYYFYYAFIILLCVYYFYYAFII 122 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 23.0 bits (47), Expect = 2.1 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 196 FASRINI*ILARHDNVYTK*FKLFYLTKRNTEMQMIKVHVH 318 F + NI + RH+ + KL T +NT +V VH Sbjct: 105 FRLKFNISSIPRHEKLTAAEIKLTRETAKNTSHPFQRVLVH 145 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.6 bits (46), Expect = 2.8 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +3 Query: 417 IL*TLYFVDVNDFFADCKWYW 479 I+ ++FV ++ C WYW Sbjct: 279 IIVLVFFVCWTPYYVMCIWYW 299 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.6 bits (46), Expect = 2.8 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +3 Query: 417 IL*TLYFVDVNDFFADCKWYW 479 I+ ++FV ++ C WYW Sbjct: 279 IIVLVFFVCWTPYYVMCIWYW 299 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,003 Number of Sequences: 336 Number of extensions: 3623 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -