BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0931 (635 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6C3.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 28 0.98 SPBC582.05c |brc1||BRCT domain protein Brc1|Schizosaccharomyces ... 25 6.9 >SPAC6C3.05 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 269 Score = 28.3 bits (60), Expect = 0.98 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +2 Query: 200 INELEFRIIHSINRTVFSKLIKPSRQSKLLTFYFETLIPFRSKKN 334 IN L+ I S N + L KP LT YF TL+ + +N Sbjct: 104 INVLQLNINASDNSLAY--LSKPEESYNFLTIYFSTLLSYEKVEN 146 >SPBC582.05c |brc1||BRCT domain protein Brc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 878 Score = 25.4 bits (53), Expect = 6.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 433 NTLLIVS*IYASKYLCIFIWNI 498 NTLLI + Y KY +WNI Sbjct: 353 NTLLIAASSYGQKYGAAKVWNI 374 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,287,539 Number of Sequences: 5004 Number of extensions: 41651 Number of successful extensions: 101 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -