BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0931 (635 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132862-33|CAB70222.3| 308|Caenorhabditis elegans Hypothetical... 27 8.5 >AL132862-33|CAB70222.3| 308|Caenorhabditis elegans Hypothetical protein Y73F8A.3 protein. Length = 308 Score = 27.5 bits (58), Expect = 8.5 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 8/49 (16%) Frame = +2 Query: 239 RTVFSKLIKPSRQSKLLTFYFE--------TLIPFRSKKNPCIFCYRLP 361 R V KL + S K TF FE TLIP +PC+ C+ P Sbjct: 220 RLVMKKLNQASTSIKTSTFQFELLRALIVQTLIPIVISFSPCLLCWYSP 268 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,130,048 Number of Sequences: 27780 Number of extensions: 215788 Number of successful extensions: 529 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 529 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1406256614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -