BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0930 (629 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.2 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 5.7 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 5.7 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 5.7 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 5.7 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 3.2 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 65 RFESVRFIDLYSRDTTYCSIRTIAYINSTHFEGTYINIYLSRSYSAL 205 R ES F+ LY+ T S + + + F G ++ L+ S +A+ Sbjct: 373 RIESNAFLPLYNLHTLELSDNKLRTVGAQLFNGLFVLNRLTLSGNAI 419 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 5.7 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +2 Query: 443 YXNNN*NVFYRXSRKSMP*NYYXMYFN 523 Y NNN N Y + NY +Y+N Sbjct: 329 YNNNNYNNNYNNYNNNNYNNYKKLYYN 355 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -3 Query: 336 DNDIWRAKHGGFSASLDGDGDI 271 + + +R G S LDG GD+ Sbjct: 569 NEETYRGGKGALSCLLDGKGDV 590 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -3 Query: 336 DNDIWRAKHGGFSASLDGDGDI 271 + + +R G S LDG GD+ Sbjct: 569 NEETYRGGKGALSCLLDGKGDV 590 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.7 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -3 Query: 336 DNDIWRAKHGGFSASLDGDGDI 271 + + +R G S LDG GD+ Sbjct: 569 NEETYRGGKGALSCLLDGKGDV 590 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,542 Number of Sequences: 438 Number of extensions: 2900 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -