BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0929 (631 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17710.1 68417.m02645 homeobox-leucine zipper family protein ... 27 7.8 >At4g17710.1 68417.m02645 homeobox-leucine zipper family protein / lipid-binding START domain-containing protein similar to HD-Zip homeo domain OCL4 protein (GI:8920425) [Zea mays]; contains Pfam PF00046: Homeobox domain and Pfam PF01852: START domain Length = 709 Score = 27.5 bits (58), Expect = 7.8 Identities = 21/57 (36%), Positives = 30/57 (52%) Frame = -1 Query: 295 VVREHPRDHVGGAHTSSPSWQLRTSLKRLRNSGSNFSRTYF*SLDFFSSVNFWVCST 125 VV +P D V G+ SSPS L +++ L GSN + T L S +N +C+T Sbjct: 643 VVPVNPSDGVEGSSVSSPSCLLTVAIQVL---GSNVT-TERLDLSTVSVINHRICAT 695 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,077,341 Number of Sequences: 28952 Number of extensions: 160425 Number of successful extensions: 321 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 321 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1285411824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -