BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0927 (629 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 4.9 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 4.9 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 4.9 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 241 FLNKYRLIVNTHKN 282 F NK + +VN HKN Sbjct: 226 FCNKIKHLVNLHKN 239 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/39 (28%), Positives = 22/39 (56%), Gaps = 7/39 (17%) Frame = +2 Query: 464 WIXNDAFK-------YGRRNSLLWVNISGVFKKXKIMKV 559 W+ ++FK + + ++LW +I VFK+ ++KV Sbjct: 379 WMSGESFKSPYKASCWAQFKAVLWRSILAVFKEPLLIKV 417 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/39 (28%), Positives = 22/39 (56%), Gaps = 7/39 (17%) Frame = +2 Query: 464 WIXNDAFK-------YGRRNSLLWVNISGVFKKXKIMKV 559 W+ ++FK + + ++LW +I VFK+ ++KV Sbjct: 379 WMSGESFKSPYKASCWAQFKAVLWRSILAVFKEPLLIKV 417 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,571 Number of Sequences: 336 Number of extensions: 2689 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -