BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0922 (696 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 24 1.0 AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 pro... 23 3.2 AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 prot... 23 3.2 AF260822-1|AAG02020.1| 138|Tribolium castaneum alpha-esterase l... 22 4.2 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 5.5 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 5.5 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 5.5 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 5.5 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 5.5 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 5.5 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 5.5 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 5.5 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 5.5 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 24.2 bits (50), Expect = 1.0 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -1 Query: 660 LENSINNTI*CLY*NAMLLQNKLIIMLKMRSIKKKRRNRTESTLTQA 520 L ++ N I CL+ + K KKKRRNR +T TQ+ Sbjct: 298 LNSAANPIIYCLFSTHFCRTLGSLPPFKWLFKKKKRRNRESTTNTQS 344 >AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 protein. Length = 384 Score = 22.6 bits (46), Expect = 3.2 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 436 CK*STYAIPYPGHGICEKFTLRLTDPNFC 522 C +++ I P +G KFT TDPN C Sbjct: 26 CYFASWTIYRPDNG---KFTALDTDPNLC 51 >AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 protein. Length = 384 Score = 22.6 bits (46), Expect = 3.2 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 436 CK*STYAIPYPGHGICEKFTLRLTDPNFC 522 C +++ I P +G KFT TDPN C Sbjct: 26 CYFASWTIYRPDNG---KFTALDTDPNLC 51 >AF260822-1|AAG02020.1| 138|Tribolium castaneum alpha-esterase like protein E3 protein. Length = 138 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -2 Query: 314 FFVFSSGNDKIRYG 273 +F+F SGND I YG Sbjct: 83 YFIFGSGNDDI-YG 95 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 451 YAIPYPGHGI 480 YA P PGHG+ Sbjct: 57 YAAPAPGHGL 66 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 451 YAIPYPGHGI 480 YA P PGHG+ Sbjct: 57 YAAPAPGHGL 66 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 451 YAIPYPGHGI 480 YA P PGHG+ Sbjct: 57 YAAPAPGHGL 66 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 451 YAIPYPGHGI 480 YA P PGHG+ Sbjct: 57 YAAPAPGHGL 66 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 451 YAIPYPGHGI 480 YA P PGHG+ Sbjct: 57 YAAPAPGHGL 66 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 451 YAIPYPGHGI 480 YA P PGHG+ Sbjct: 13 YAAPAPGHGL 22 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 451 YAIPYPGHGI 480 YA P PGHG+ Sbjct: 57 YAAPAPGHGL 66 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 451 YAIPYPGHGI 480 YA P PGHG+ Sbjct: 57 YAAPAPGHGL 66 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 5.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 451 YAIPYPGHGI 480 YA P PGHG+ Sbjct: 57 YAAPAPGHGL 66 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,332 Number of Sequences: 336 Number of extensions: 3145 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -