BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0921 (688 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 9.5 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 21 9.5 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.0 bits (42), Expect = 9.5 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +3 Query: 579 MNFKINLIFFREILNECDDKHFINYKSAPIILKN 680 M FKI+ + F +L ++ + ILKN Sbjct: 1 MIFKIHFLVFGALLTYVSSVEYLILREIDTILKN 34 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 21.0 bits (42), Expect = 9.5 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 372 RQRNAKFSKLTWQP 413 R+R K +K+TW+P Sbjct: 139 RRRLKKENKMTWEP 152 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,598 Number of Sequences: 336 Number of extensions: 3538 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -