BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0921 (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1687.16c |erg3||C-5 sterol desaturase Erg3 |Schizosaccharomy... 29 0.83 SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytoch... 26 4.4 SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion ... 26 4.4 >SPAC1687.16c |erg3||C-5 sterol desaturase Erg3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 300 Score = 28.7 bits (61), Expect = 0.83 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = +3 Query: 327 IIFIHYGFFVQYRILRQRNA--KFSKL--TWQPCIVPSNYVYRSVK*ALQSLISFRFFFF 494 ++F +G + +R L R + KL W C +++ ++S LQSL F FF Sbjct: 126 VMFSDFGIYWAHRFLHHRYVYPRLHKLHHKWIICTPYASHAFKSADGFLQSLPYHLFPFF 185 Query: 495 NPFH 506 P H Sbjct: 186 FPLH 189 >SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytochrome c oxidase assembly protein Cox1101, mitochondrial ribosomal protein Rsm22|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 26.2 bits (55), Expect = 4.4 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 180 PF*NKIAYNIHHNI 221 PF KI Y+IHHNI Sbjct: 208 PFLKKIIYDIHHNI 221 >SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion cytochrome c oxidase assembly protein Cox1102, mitochondrial ribosomal protein Rsm2202|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 26.2 bits (55), Expect = 4.4 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 180 PF*NKIAYNIHHNI 221 PF KI Y+IHHNI Sbjct: 208 PFLKKIIYDIHHNI 221 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,661,692 Number of Sequences: 5004 Number of extensions: 53167 Number of successful extensions: 101 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -