BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0921 (688 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22740.1 68416.m02868 homocysteine S-methyltransferase 3 (HMT... 30 1.3 At1g29590.1 68414.m03618 eukaryotic translation initiation facto... 29 2.9 At1g29550.1 68414.m03614 eukaryotic translation initiation facto... 29 2.9 >At3g22740.1 68416.m02868 homocysteine S-methyltransferase 3 (HMT-3) identical to homocysteine S-methyltransferase HMT-3 [Arabidopsis thaliana] GI:9966515; similar to homocysteine S-methyltransferase AtHMT-2 (GI:6685163) [Arabidopsis thaliana]; similar to selenocysteine methyltransferase GB:P56707 from [Astragalus bisulcatus] Length = 347 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 569 KVLRKSVCLQKSQTSIFDGLSVKWIKKK-ESETD 471 ++ RK + + + ++DGL+ KWIK + ESE D Sbjct: 266 QMTRKPIVVYPNSGEVYDGLNKKWIKSEGESEED 299 >At1g29590.1 68414.m03618 eukaryotic translation initiation factor 4E, putative / eIF-4E, putative / eIF4E, putative / mRNA cap-binding protein, putative similar to SP|O23252 Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (mRNA cap-binding protein) (eIF-4F 25 kDa subunit) (eIF-4F P26 subunit) {Arabidopsis thaliana}; contains Pfam profile PF01652: Eukaryotic initiation factor 4E Length = 285 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -3 Query: 611 PEKNKVNFKVHNEFKVLRKSVCLQKSQTSIFDGLSVK 501 P K K N+ V++KS C Q S T FD S K Sbjct: 90 PSKEKKNYASKKSTTVIQKSHCFQNSWTFWFDNPSSK 126 >At1g29550.1 68414.m03614 eukaryotic translation initiation factor 4E, putative / eIF-4E, putative / eIF4E, putative / mRNA cap-binding protein, putative similar to SP|O23252 Eukaryotic translation initiation factor 4E (eIF-4E) (eIF4E) (mRNA cap-binding protein) (eIF-4F 25 kDa subunit) (eIF-4F P26 subunit) {Arabidopsis thaliana}; contains Pfam profile PF01652: Eukaryotic initiation factor 4E Length = 240 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -3 Query: 611 PEKNKVNFKVHNEFKVLRKSVCLQKSQTSIFDGLSVK 501 P K K N+ V++KS C Q S T FD S K Sbjct: 45 PSKEKKNYASKKSTTVIQKSHCFQNSWTFWFDNPSSK 81 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,036,168 Number of Sequences: 28952 Number of extensions: 245914 Number of successful extensions: 417 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -