BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0918 (690 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC112275-1|AAI12276.1| 1011|Homo sapiens hypothetical protein LO... 31 5.1 BC101628-1|AAI01629.1| 1011|Homo sapiens family with sequence si... 31 5.1 AL512363-1|CAI15113.1| 1011|Homo sapiens el gene, the 5' end of ... 31 5.1 AL049555-1|CAI21667.1| 1011|Homo sapiens protein ( Human DNA seq... 31 5.1 AK055204-1|BAB70873.1| 811|Homo sapiens protein ( Homo sapiens ... 31 5.1 >BC112275-1|AAI12276.1| 1011|Homo sapiens hypothetical protein LOC222584 protein. Length = 1011 Score = 30.7 bits (66), Expect = 5.1 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 75 FINSLAVKKFRRLYNEKIHSEVRKAHNRDFNHVQHLLKRFPNLDMDT 215 F N LA +K L + +S VR++ N NH++ L +R P L+ T Sbjct: 444 FANRLAQRKTTNLADR--NSNVRRSFNGTDNHIRFLQQRMPTLEHTT 488 >BC101628-1|AAI01629.1| 1011|Homo sapiens family with sequence similarity 83, member B protein. Length = 1011 Score = 30.7 bits (66), Expect = 5.1 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 75 FINSLAVKKFRRLYNEKIHSEVRKAHNRDFNHVQHLLKRFPNLDMDT 215 F N LA +K L + +S VR++ N NH++ L +R P L+ T Sbjct: 444 FANRLAQRKTTNLADR--NSNVRRSFNGTDNHIRFLQQRMPTLEHTT 488 >AL512363-1|CAI15113.1| 1011|Homo sapiens el gene, the 5' end of the gene for a novel proteinA, member 8) protein. Length = 1011 Score = 30.7 bits (66), Expect = 5.1 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 75 FINSLAVKKFRRLYNEKIHSEVRKAHNRDFNHVQHLLKRFPNLDMDT 215 F N LA +K L + +S VR++ N NH++ L +R P L+ T Sbjct: 444 FANRLAQRKTTNLADR--NSNVRRSFNGTDNHIRFLQQRMPTLEHTT 488 >AL049555-1|CAI21667.1| 1011|Homo sapiens protein ( Human DNA sequence from clone RP3-523K23 on chromosome 6p12.1-12.3 Contains the 3' end of the gene for a novel protein. ). Length = 1011 Score = 30.7 bits (66), Expect = 5.1 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 75 FINSLAVKKFRRLYNEKIHSEVRKAHNRDFNHVQHLLKRFPNLDMDT 215 F N LA +K L + +S VR++ N NH++ L +R P L+ T Sbjct: 444 FANRLAQRKTTNLADR--NSNVRRSFNGTDNHIRFLQQRMPTLEHTT 488 >AK055204-1|BAB70873.1| 811|Homo sapiens protein ( Homo sapiens cDNA FLJ30642 fis, clone CTONG2002965. ). Length = 811 Score = 30.7 bits (66), Expect = 5.1 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +3 Query: 75 FINSLAVKKFRRLYNEKIHSEVRKAHNRDFNHVQHLLKRFPNLDMDT 215 F N LA +K L + +S VR++ N NH++ L +R P L+ T Sbjct: 444 FANRLAQRKTTNLADR--NSNVRRSFNGTDNHIRFLQQRMPTLEHTT 488 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,396,550 Number of Sequences: 237096 Number of extensions: 1652279 Number of successful extensions: 2508 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2508 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7895240574 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -