BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0917 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46525| Best HMM Match : Thymosin (HMM E-Value=0) 68 6e-12 SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) 36 0.032 SB_39938| Best HMM Match : ANF_receptor (HMM E-Value=6.4e-14) 30 1.6 SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) 30 1.6 SB_57255| Best HMM Match : Atrophin-1 (HMM E-Value=0.91) 30 2.1 SB_20129| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) 29 3.6 SB_29288| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_7539| Best HMM Match : Sulfatase (HMM E-Value=3.5e-05) 29 4.8 SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) 29 4.8 SB_1586| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 28 6.3 SB_14886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_34331| Best HMM Match : Transposase_21 (HMM E-Value=0.00032) 28 8.4 >SB_46525| Best HMM Match : Thymosin (HMM E-Value=0) Length = 750 Score = 68.1 bits (159), Expect = 6e-12 Identities = 33/65 (50%), Positives = 43/65 (66%) Frame = +3 Query: 255 SSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTKDVIE 434 +S+LKH E QEKNPLP KD I E + + ++ FD +KLKH +T EKNPLP I Sbjct: 688 ASKLKHVEVQEKNPLPTKDDITTESTETRA--EVKTFDHSKLKHVQTEEKNPLPDAKTIA 745 Query: 435 QEKSA 449 QEK++ Sbjct: 746 QEKAS 750 Score = 65.3 bits (152), Expect = 5e-11 Identities = 33/61 (54%), Positives = 38/61 (62%) Frame = +3 Query: 258 SQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTKDVIEQ 437 S+L+H ET+EKN LP KD I EK F +G+E F KLKH ET EKNPLP I Sbjct: 460 SKLQHVETKEKNTLPTKDTIADEKRTAPF-SGVEVFQKNKLKHVETLEKNPLPDAQNIRA 518 Query: 438 E 440 E Sbjct: 519 E 519 Score = 63.3 bits (147), Expect = 2e-10 Identities = 31/65 (47%), Positives = 40/65 (61%), Gaps = 2/65 (3%) Frame = +3 Query: 258 SQLKHTETQEKNPLPDKDAIEAEKEKNKF--LNGIENFDPTKLKHTETCEKNPLPTKDVI 431 S+LKH ET EKNPLP ++ E ++ + +FD +KLKH E EKNPLPTKD I Sbjct: 649 SKLKHVETVEKNPLPSAAVLKEEMRPEVLPDVSAVASFDASKLKHVEVQEKNPLPTKDDI 708 Query: 432 EQEKS 446 E + Sbjct: 709 TTEST 713 Score = 62.9 bits (146), Expect = 2e-10 Identities = 30/65 (46%), Positives = 44/65 (67%), Gaps = 2/65 (3%) Frame = +3 Query: 255 SSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIE--NFDPTKLKHTETCEKNPLPTKDV 428 ++ LKH +T+EKN LP + I+ E + ++F + E +F+ +KL+H ET EKN LPTKD Sbjct: 419 AANLKHVQTKEKNTLPSDETIKQELQPDEFPDRAEVKSFEKSKLQHVETKEKNTLPTKDT 478 Query: 429 IEQEK 443 I EK Sbjct: 479 IADEK 483 Score = 62.9 bits (146), Expect = 2e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 2/63 (3%) Frame = +3 Query: 258 SQLKHTETQEKNPLPDKDAIEAEK--EKNKFLNGIENFDPTKLKHTETCEKNPLPTKDVI 431 ++LKH ET EKNPLPD I AE E + + FD +KLKH ET EK +PTKDVI Sbjct: 497 NKLKHVETLEKNPLPDAQNIRAEMMPEVLPDRSEVAKFDTSKLKHVETKEKVVMPTKDVI 556 Query: 432 EQE 440 E E Sbjct: 557 EAE 559 Score = 61.3 bits (142), Expect = 7e-10 Identities = 30/62 (48%), Positives = 42/62 (67%) Frame = +3 Query: 255 SSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTKDVIE 434 +S+LKH ET+EK +P KD IEAE ++ +++FD +KLKH T EKNPLPT + Sbjct: 536 TSKLKHVETKEKVVMPTKDVIEAEAIDSRA--EVKSFDHSKLKHVVTQEKNPLPTPQTLH 593 Query: 435 QE 440 +E Sbjct: 594 EE 595 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/61 (42%), Positives = 43/61 (70%) Frame = +3 Query: 258 SQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTKDVIEQ 437 ++LKH TQEK+ +P ++ I+ E ++ +++FD +KLKH ET EKNPLP+ V+++ Sbjct: 613 TKLKHVTTQEKSIMPSQEDIKEEAVDSRA--EVKSFDHSKLKHVETVEKNPLPSAAVLKE 670 Query: 438 E 440 E Sbjct: 671 E 671 Score = 54.0 bits (124), Expect = 1e-07 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +3 Query: 258 SQLKHTETQEKNPLPDKDAIEAEK-EKNK-FLNGIENFDPTKLKHTETCEKNPLPTKDVI 431 S+LKH TQEKNPLP + E KNK + + +FD TKLKH T EK+ +P+++ I Sbjct: 573 SKLKHVVTQEKNPLPTPQTLHEELIPKNKPDRSEVASFDHTKLKHVTTQEKSIMPSQEDI 632 Query: 432 EQE 440 ++E Sbjct: 633 KEE 635 Score = 35.1 bits (77), Expect = 0.055 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +3 Query: 354 IENFDPTKLKHTETCEKNPLPTKDVIEQE 440 + FD LKH +T EKN LP+ + I+QE Sbjct: 414 VAKFDAANLKHVQTKEKNTLPSDETIKQE 442 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/40 (37%), Positives = 28/40 (70%) Frame = +1 Query: 94 LPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 213 +P+V D +S++ F+TS L+ V+T EK+V+P+ + + E Sbjct: 521 MPEVLPD-RSEVAKFDTSKLKHVETKEKVVMPTKDVIEAE 559 Score = 31.5 bits (68), Expect = 0.68 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +1 Query: 94 LPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 213 +PK D +S++ F+ + L+ V T EK ++PS ED+ E Sbjct: 597 IPKNKPD-RSEVASFDHTKLKHVTTQEKSIMPSQEDIKEE 635 >SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) Length = 413 Score = 35.9 bits (79), Expect = 0.032 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +1 Query: 82 SLKDLPKVATDLKSQLEGFNTSCL-RDVDTNEKIVLPSAEDVATEKTQKSLFD 237 SLK L K+ TDL+S ++G ++ L ++V+ K+V + +T K + S F+ Sbjct: 333 SLKALAKICTDLESNIQGIKSNPLAKEVERTNKLVYEIFKKFSTSKVEASSFE 385 >SB_39938| Best HMM Match : ANF_receptor (HMM E-Value=6.4e-14) Length = 966 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 287 EEPASGQRCYRSGEGKEQIPERHRELRSH*AEAHGNVREEP 409 EEP+ + +G KE+ E RE R H + V+EEP Sbjct: 840 EEPSDEEESEEAGREKEEEEEDQREGRDHNDDEESVVKEEP 880 >SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 30.3 bits (65), Expect = 1.6 Identities = 27/73 (36%), Positives = 33/73 (45%), Gaps = 5/73 (6%) Frame = +2 Query: 152 SVTSTPMKRLCFRLLKTSPLRRPRSLYSTVS-RSLIE----PAEAHRDSGEEPASGQRCY 316 SVT T +RL R S L PRS+ T S R+L A R GEE G+ Y Sbjct: 438 SVTGTFARRLVSRTTDASSLEDPRSVVVTSSPRTLGRISNGTTSARRVEGEEHVCGE--Y 495 Query: 317 RSGEGKEQIPERH 355 + KE +P H Sbjct: 496 KCSLCKEVVPPDH 508 >SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) Length = 385 Score = 30.3 bits (65), Expect = 1.6 Identities = 20/48 (41%), Positives = 27/48 (56%) Frame = -3 Query: 219 GLLSGDVFSRRKHNLFIGVDVTETAGVEAFELTLQVCGDLGEVFQGGS 76 GLL+GD+F R K N+ I VD T G + FEL + + E+ GS Sbjct: 74 GLLAGDIFRRPKANILISVDGV-TKG-DKFELPAKASFPVQEMAGLGS 119 >SB_57255| Best HMM Match : Atrophin-1 (HMM E-Value=0.91) Length = 1249 Score = 29.9 bits (64), Expect = 2.1 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 64 SVSDTPSLKDLPKVATDLKSQLEGFNTSCLRDV-DTNEKIVLPSAEDVAT 210 S SD P+ D A+D+KS + T DV T++ V PSA DV T Sbjct: 617 SASDVPTTSDDQPSASDVKSTSDDQVTPPSSDVPTTSDDQVTPSASDVPT 666 >SB_20129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = -3 Query: 219 GLLSGDVFSRRKHNLFIGVDVTETAGVEAFEL 124 GLL+GD+F R K N+ I VD T G + FEL Sbjct: 51 GLLAGDIFRRPKANILISVDGV-TKG-DKFEL 80 >SB_31788| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 352 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 632 RI*IKIRGCCTSPLPRQCCP 573 R+ +K RG C +P PR+ CP Sbjct: 217 RLKLKYRGACGNPTPRKSCP 236 >SB_29288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +3 Query: 267 KHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEK 404 +HTE + +P P K I+ E +++ + I+ KH+ +CE+ Sbjct: 212 RHTENAKSSPDPIKSEIDGEHSEDEKEHKIKVCPLVDKKHSHSCER 257 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.7 bits (61), Expect = 4.8 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 5/89 (5%) Frame = +2 Query: 89 KTSPRSPQT*RVSSKAS-----TPAVSVTSTPMKRLCFRLLKTSPLRRPRSLYSTVSRSL 253 +++P SP SS S +P SV + +K + +KT+P R + TVS L Sbjct: 383 ESNPASPTGSTSSSDGSVYNPCSPDSSVLTNILKHPSGKEIKTTPYSRKNTKSDTVSPKL 442 Query: 254 IEPAEAHRDSGEEPASGQRCYRSGEGKEQ 340 PA+ R + + R YR + EQ Sbjct: 443 KTPAQRQRKRVQNKDAATR-YRVKKKDEQ 470 >SB_7539| Best HMM Match : Sulfatase (HMM E-Value=3.5e-05) Length = 492 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 214 SQWRRLQQTEAQSFHWCRRHGDSWC*SLRADSSGLWRPW 98 S WRRLQ+ A S + + D +L A+ G W PW Sbjct: 419 SLWRRLQELNATSLEYRLQPEDPRSIAL-AERLGRWEPW 456 >SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) Length = 1452 Score = 28.7 bits (61), Expect = 4.8 Identities = 19/60 (31%), Positives = 26/60 (43%) Frame = +3 Query: 261 QLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTKDVIEQE 440 Q K E PD+D +E E+E NG+E+ D K + PT DV Q+ Sbjct: 843 QRKRLEQHASYEAPDEDEMEIERE---LQNGLESGDEDDTKADAQRSETNSPTLDVETQQ 899 >SB_1586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 206 PLRRPRSLYSTVSR--SLIEPAEAHRDSGEEPASGQ 307 P + PR+ S VSR S++ P+ H D P SGQ Sbjct: 299 PFQVPRNSVSFVSRRASVLSPSPKHSDYSGRPTSGQ 334 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 85 LKDLPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 213 L DL +V +LKS+ EG CL D++ + DV E Sbjct: 1125 LMDLSRVGEELKSENEGLQQKCL-DLEKQRDTIKQDLADVQKE 1166 >SB_14886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1028 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 461 FITVTRKCISLVSPXFILM*VRSICVVHYKFYFCFCTMGNTA 586 F T +SL S ++ +R IC VH FY+C C + A Sbjct: 39 FRLATHVILSLESRDTLVAVLR-ICSVHLDFYYCTCVWSSMA 79 >SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 259 LDQTSRYRRIKTSGSSQWRRLQQTEAQSFHWCRRHGD 149 L +TS Y ++ SGSS RRL+ S+ R GD Sbjct: 38 LSKTSSYGDVELSGSSSRRRLRVMAMSSYRGVRVIGD 74 >SB_34331| Best HMM Match : Transposase_21 (HMM E-Value=0.00032) Length = 276 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +2 Query: 242 SRSLIEPAEAHRDSGEEP 295 SRSLIEP+EAH ++ EP Sbjct: 257 SRSLIEPSEAHCNAALEP 274 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,158,415 Number of Sequences: 59808 Number of extensions: 463014 Number of successful extensions: 1499 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1489 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -