BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0913 (693 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77656-2|CAE17769.1| 724|Caenorhabditis elegans Hypothetical pr... 28 5.5 Z50029-4|CAB63417.1| 1082|Caenorhabditis elegans Hypothetical pr... 28 7.3 >Z77656-2|CAE17769.1| 724|Caenorhabditis elegans Hypothetical protein F07B10.4 protein. Length = 724 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/31 (32%), Positives = 21/31 (67%) Frame = -2 Query: 392 KTSHFHIRIVLSVISFVIVRAIFIVIPHTLI 300 KT +HI++ + + +++A+F+V+P T I Sbjct: 627 KTVKYHIQVTVLFLCSCVIQALFVVLPVTHI 657 >Z50029-4|CAB63417.1| 1082|Caenorhabditis elegans Hypothetical protein ZC504.4b protein. Length = 1082 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 1 RHEPTSRPGPRSSQQ 45 RH P SRP PRS QQ Sbjct: 421 RHSPASRPRPRSPQQ 435 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,154,292 Number of Sequences: 27780 Number of extensions: 304184 Number of successful extensions: 940 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 870 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 940 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -