BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0910 (693 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U66146-1|AAC51165.1| 592|Homo sapiens CD6e protein. 31 5.2 L78838-2|AAL40085.1| 592|Homo sapiens T cell surface glycoprote... 31 5.2 >U66146-1|AAC51165.1| 592|Homo sapiens CD6e protein. Length = 592 Score = 30.7 bits (66), Expect = 5.2 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +1 Query: 226 LAVVLQRRDWKTLALPNLIALQHIPLS-PAGVIAKRPAPIALPNSCAPEWRMAN 384 +A +L R K ALP ++ QH+P + PAG + +P PI +P + R+ + Sbjct: 419 IAFILLRIKGK-YALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEDSQRHRVTD 471 >L78838-2|AAL40085.1| 592|Homo sapiens T cell surface glycoprotein CD6 isoform e protein. Length = 592 Score = 30.7 bits (66), Expect = 5.2 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +1 Query: 226 LAVVLQRRDWKTLALPNLIALQHIPLS-PAGVIAKRPAPIALPNSCAPEWRMAN 384 +A +L R K ALP ++ QH+P + PAG + +P PI +P + R+ + Sbjct: 419 IAFILLRIKGK-YALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEDSQRHRVTD 471 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,795,210 Number of Sequences: 237096 Number of extensions: 2486149 Number of successful extensions: 4766 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4766 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7951235188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -