BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0909 (686 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060936-1|AAL28484.1| 585|Drosophila melanogaster GM07803p pro... 32 0.85 AE014134-1643|AAS64663.1| 1494|Drosophila melanogaster CG33298-P... 32 0.85 AE014134-1642|AAS64662.1| 1517|Drosophila melanogaster CG33298-P... 32 0.85 >AY060936-1|AAL28484.1| 585|Drosophila melanogaster GM07803p protein. Length = 585 Score = 31.9 bits (69), Expect = 0.85 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +3 Query: 162 CIFLAAVWNISFFLKYVIWLRFIYLFCVP-DSLTMRCFRIIHSFW 293 C W + L V+ L YLF + DS+ M CF + S+W Sbjct: 453 CAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYW 497 >AE014134-1643|AAS64663.1| 1494|Drosophila melanogaster CG33298-PA, isoform A protein. Length = 1494 Score = 31.9 bits (69), Expect = 0.85 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +3 Query: 162 CIFLAAVWNISFFLKYVIWLRFIYLFCVP-DSLTMRCFRIIHSFW 293 C W + L V+ L YLF + DS+ M CF + S+W Sbjct: 1385 CAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYW 1429 >AE014134-1642|AAS64662.1| 1517|Drosophila melanogaster CG33298-PB, isoform B protein. Length = 1517 Score = 31.9 bits (69), Expect = 0.85 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +3 Query: 162 CIFLAAVWNISFFLKYVIWLRFIYLFCVP-DSLTMRCFRIIHSFW 293 C W + L V+ L YLF + DS+ M CF + S+W Sbjct: 1385 CAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYW 1429 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,136,616 Number of Sequences: 53049 Number of extensions: 547745 Number of successful extensions: 834 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 3013199100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -