BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0909 (686 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92829-10|CAB07350.2| 319|Caenorhabditis elegans Hypothetical p... 27 9.5 Z81554-1|CAB04506.1| 838|Caenorhabditis elegans Hypothetical pr... 27 9.5 U50300-5|AAC48103.2| 337|Caenorhabditis elegans Serpentine rece... 27 9.5 AF100306-8|ABB88213.1| 860|Caenorhabditis elegans Hypothetical ... 27 9.5 AF100306-7|ABB88214.1| 895|Caenorhabditis elegans Hypothetical ... 27 9.5 >Z92829-10|CAB07350.2| 319|Caenorhabditis elegans Hypothetical protein F10A3.15 protein. Length = 319 Score = 27.5 bits (58), Expect = 9.5 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 174 AAVWNISFFLKYVIWLRFIYLFCVPDSLTMRCFRIIHSFWDTLYIRN 314 A +W IS + +VIW F F + M+ +I FW+ +++ Sbjct: 134 APIWVISLSVNFVIW--FFCFFNLNSPSPMKDEELIPEFWEAYCLKS 178 >Z81554-1|CAB04506.1| 838|Caenorhabditis elegans Hypothetical protein F57G4.1 protein. Length = 838 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 246 PDSLTMRCFRIIHSFWDTLY 305 P +T+RCF+ HSF+ T Y Sbjct: 569 PREITIRCFQESHSFYVTFY 588 >U50300-5|AAC48103.2| 337|Caenorhabditis elegans Serpentine receptor, class t protein18 protein. Length = 337 Score = 27.5 bits (58), Expect = 9.5 Identities = 8/24 (33%), Positives = 18/24 (75%) Frame = +1 Query: 283 ILSGTLCIYVIFMYIYSKYLIFSI 354 ++ G C+YVI+ +++K +IF++ Sbjct: 171 VILGIFCVYVIYPMLFTKPIIFNL 194 >AF100306-8|ABB88213.1| 860|Caenorhabditis elegans Hypothetical protein T24C4.6a protein. Length = 860 Score = 27.5 bits (58), Expect = 9.5 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -1 Query: 359 KLILKIRYLLYMYINITYIQSVPERMDNP 273 KLI+ ++YL ++ I+ T + + P DNP Sbjct: 353 KLIVSLKYLTHLDISSTNLATQPSSHDNP 381 >AF100306-7|ABB88214.1| 895|Caenorhabditis elegans Hypothetical protein T24C4.6b protein. Length = 895 Score = 27.5 bits (58), Expect = 9.5 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -1 Query: 359 KLILKIRYLLYMYINITYIQSVPERMDNP 273 KLI+ ++YL ++ I+ T + + P DNP Sbjct: 353 KLIVSLKYLTHLDISSTNLATQPSSHDNP 381 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,196,205 Number of Sequences: 27780 Number of extensions: 311234 Number of successful extensions: 522 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -