BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0907 (691 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0536 - 4622767-4622865,4623550-4623673,4624571-4624685,462... 29 4.6 04_01_0529 - 6921152-6921544 29 4.6 >05_01_0536 - 4622767-4622865,4623550-4623673,4624571-4624685, 4624784-4625028,4625081-4625316 Length = 272 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 480 WKFIKIRM*NHVVGTLHTGIILCLHILIIDR 388 WK+ K N + G+ H G C+ LII R Sbjct: 198 WKYSKFLEINSIPGSCHFGSFCCIFALIISR 228 >04_01_0529 - 6921152-6921544 Length = 130 Score = 28.7 bits (61), Expect = 4.6 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 3/72 (4%) Frame = -2 Query: 273 MRVVDKFS*IKVDIKNIALKIEIILATKISLN---LPIL*QTNF*NSLCTKQLKCGNRYI 103 MR+ K +K ++ AL + + LAT + +P L ++ + LC K GN + Sbjct: 20 MRISYKVMAVKARSRHDAL-VALPLATSATFVGEVIPFLVRSGCPHILCLSHKKLGNAFA 78 Query: 102 GTYCSLKTTLEQ 67 YC + T++Q Sbjct: 79 TCYCRARMTMQQ 90 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,922,789 Number of Sequences: 37544 Number of extensions: 302250 Number of successful extensions: 538 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 538 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -