BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0904 (694 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g45207.2 68414.m05186 remorin family protein Since this genom... 34 0.078 At5g37010.1 68418.m04438 expressed protein 29 2.9 At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger) fa... 28 6.8 At2g37100.1 68415.m04552 protamine P1 family protein contains Pf... 28 6.8 At3g56130.1 68416.m06238 biotin/lipoyl attachment domain-contain... 27 8.9 >At1g45207.2 68414.m05186 remorin family protein Since this genomic sequence region is unfinished, the annotated gene may be missing a stop codon or start codon Length = 555 Score = 34.3 bits (75), Expect = 0.078 Identities = 30/102 (29%), Positives = 46/102 (45%), Gaps = 1/102 (0%) Frame = -1 Query: 391 QNINAYNLPFAIQVRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTQGFPSHDVVKRRPV 212 QN+++ F++ +R C E RS R+ +L ++L + LS VT P VKR V Sbjct: 118 QNLDSARSSFSVALRECQERRS-RSEALAKKLDYQRTVSLDLSNVTSTSPRVVNVKRASV 176 Query: 211 NCNTTHYRANWVPG-PHHQRKRHDGGSENRAAPAKGEGNTKP 89 + N + + PG P + G S R P + G P Sbjct: 177 STNKSSVFPS--PGTPTYLHSMQKGWSSER-VPLRSNGGRSP 215 >At5g37010.1 68418.m04438 expressed protein Length = 637 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -2 Query: 225 NDGQ*IVIRLTIGR-IGYRARTISGNDMTAAARTAPRQLKAKVIPNQSYRRSPINPRRP 52 N+G V R+T+ R +G A S + AA++ +P +L K + YRR+P++ P Sbjct: 257 NNGDGSVKRITVKRNVGKAASPRSQSPARAASQPSPSKLSRKT-EHSPYRRNPLSEIDP 314 >At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger) family protein similar to C-terminal zinc-finger [Glycine max] GI:558543; contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 486 Score = 27.9 bits (59), Expect = 6.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 542 TPTSKGEKPSIRAMAHYVNHHP 607 T +S+ PS+ HY++HHP Sbjct: 260 TSSSRNPTPSVYQRNHYISHHP 281 >At2g37100.1 68415.m04552 protamine P1 family protein contains Pfam PF00260: Protamine P1 Length = 297 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/65 (26%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = -1 Query: 277 ARRLSWVTQGFPSHDVVKRRPVNCNTTHYRANWVPGPH--HQRKRHDGGSENRAAPAKGE 104 +RR WV FP H C + +R W H +K S +R+ P G Sbjct: 94 SRRCGWVKNAFPCHSFTGIIKPTCFSPVWR-KWKSFSHASFSKKSEKRSSSSRSEPIFGR 152 Query: 103 GNTKP 89 +P Sbjct: 153 STVEP 157 >At3g56130.1 68416.m06238 biotin/lipoyl attachment domain-containing protein low similarity to SP|Q06881 Biotin carboxyl carrier protein of acetyl-CoA carboxylase (BCCP) {Anabaena sp.}; contains Pfam profile PF00364: Biotin-requiring enzyme Length = 281 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 340 NSCAPEWRMANCKR*YFVKIRVK 408 NSC P WR++N Y + +R K Sbjct: 36 NSCVPRWRLSNRNSNYRLVLRAK 58 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,636,506 Number of Sequences: 28952 Number of extensions: 345628 Number of successful extensions: 738 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 718 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 738 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -