BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0903 (424 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 25 1.5 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 25 1.5 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 3.5 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 3.5 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 6.0 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 22 8.0 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 22 8.0 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 22 8.0 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 22 8.0 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 24.6 bits (51), Expect = 1.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 309 ADVGPGSADLEFKG 350 ADVGPG+ + EF G Sbjct: 145 ADVGPGAGEREFNG 158 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 24.6 bits (51), Expect = 1.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 309 ADVGPGSADLEFKG 350 ADVGPG+ + EF G Sbjct: 145 ADVGPGAGEREFNG 158 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 3.5 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +3 Query: 300 DKKADVGPGSADLEFKGGYGRGRP 371 DK + P S K GYG G P Sbjct: 678 DKLLNTMPASPASSIKSGYGEGAP 701 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 3.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -2 Query: 357 HSLP*IQDQLSLDQHQPFYHEVQHQGQQEY 268 H LP Q Q +H P + H QQ+Y Sbjct: 604 HYLPLQQQQQQQARHLPQQQAIHHIHQQQY 633 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 22.6 bits (46), Expect = 6.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 187 RTETVRRGPVGRPDAPAR 240 R E GPVG P AP R Sbjct: 62 RGEKGNSGPVGPPGAPGR 79 Score = 22.6 bits (46), Expect = 6.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 205 RGPVGRPDAPARSAED 252 +GP G P AP R D Sbjct: 166 KGPAGHPGAPGRPGVD 181 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/48 (20%), Positives = 26/48 (54%) Frame = +1 Query: 34 AMQSLKSRGYVKEQFAWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLK 177 A+++ R Y+ + +W++T++ EY+ IF+ + + ++K Sbjct: 1149 ALKAKPIRRYIPKHRIQYKVWWFVTSQPFEYM-IFVLIMINTITLSMK 1195 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.2 bits (45), Expect = 8.0 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 142 HLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSA 246 +LP I P L+ + RR +G D P S+ Sbjct: 455 YLPASINPVKLRETSTIRRQRRTALGNRDEPHSSS 489 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 22.2 bits (45), Expect = 8.0 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 Query: 142 HLPPEIVPATLKRSVRTETVRRGPVGRPDAPARSA 246 +LP I P L+ + RR +G D P S+ Sbjct: 456 YLPASINPVKLRETSTIRRQRRTALGNRDEPHSSS 490 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 22.2 bits (45), Expect = 8.0 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 Query: 333 QLSLDQHQPFYHEVQHQGQQEY 268 Q QH H+ Q Q QQ+Y Sbjct: 305 QQQQQQHHHHQHQPQQQHQQQY 326 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 387,610 Number of Sequences: 2352 Number of extensions: 6673 Number of successful extensions: 17 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -