BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0902 (660 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0) 29 4.4 SB_2672| Best HMM Match : GSHPx (HMM E-Value=4.1e-14) 28 7.7 >SB_42595| Best HMM Match : Thioredoxin (HMM E-Value=0) Length = 536 Score = 28.7 bits (61), Expect = 4.4 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +2 Query: 338 LIKITPIEFPYGEPTADDINYTILKENGQCLVTKKLEPEFGQIQALEEFDSDRKKM 505 LI + + +PTA +I +KE Q + KKL+P + E++DS K+ Sbjct: 333 LINLADDDMTKYKPTAAEITSENVKEFVQAFLDKKLKPHLLSAEIPEDWDSKPVKV 388 >SB_2672| Best HMM Match : GSHPx (HMM E-Value=4.1e-14) Length = 444 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +3 Query: 90 KGYKHPGGIRYPGGITYYPRFPDYKDPEITPSKLFRVERIK 212 KG + GG++ PG + P P K P + S L+ R + Sbjct: 233 KGKEVKGGLKMPGKVAANPLPPSTKQPGLAQSLLYSGSRFQ 273 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,264,935 Number of Sequences: 59808 Number of extensions: 434755 Number of successful extensions: 817 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -