BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0901 (549 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58760-2|AAK31460.1| 130|Caenorhabditis elegans Ribosomal prote... 48 6e-06 Z81147-4|CAB03529.1| 578|Caenorhabditis elegans Hypothetical pr... 28 3.9 AF045641-5|AAC02577.2| 554|Caenorhabditis elegans Hypothetical ... 27 6.7 U58760-3|AAL02443.1| 53|Caenorhabditis elegans Ribosomal prote... 27 8.9 >U58760-2|AAK31460.1| 130|Caenorhabditis elegans Ribosomal protein, large subunitprotein 22, isoform a protein. Length = 130 Score = 47.6 bits (108), Expect = 6e-06 Identities = 19/40 (47%), Positives = 28/40 (70%) Frame = +1 Query: 139 NLKFTIDCTHPAEDSILDVGNFEKYLKEHVKVEGKTNNLA 258 +LKF ++C +P ED IL + + E +L E +KV GKT +LA Sbjct: 20 HLKFNVECKNPVEDGILRIEDLEAFLNEKIKVNGKTGHLA 59 Score = 45.2 bits (102), Expect = 3e-05 Identities = 22/60 (36%), Positives = 33/60 (55%) Frame = +3 Query: 255 SNHVVVARDKTKVAITADIPFSXXXXXXXXXXXXXXXXXXDWLRVVASAHDAYELRYFNI 434 +N+V V K+KV++ +++PFS DWLRVVA + YE+RYF+I Sbjct: 60 ANNVKVEVAKSKVSVVSEVPFSKRYLKYLTKKYLKRNSLRDWLRVVAVNKNTYEVRYFHI 119 >Z81147-4|CAB03529.1| 578|Caenorhabditis elegans Hypothetical protein T09E11.5 protein. Length = 578 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 Query: 107 LPPFTPFLPVFWCNWAFLATGFFVTAIVAN 18 L F FL ++AF+ T FF T +VAN Sbjct: 410 LKEFVDFLEASQPDYAFILTRFFATGVVAN 439 >AF045641-5|AAC02577.2| 554|Caenorhabditis elegans Hypothetical protein F53H1.3 protein. Length = 554 Score = 27.5 bits (58), Expect = 6.7 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -1 Query: 279 PWRRQRDC*VICFALNFDVFLQVFLEVTYV*DTILSGMRAVD 154 PW R RD + FD+ L LEV Y D ILS ++ Sbjct: 7 PWDRFRDWLHCICVVTFDLELGQALEVIYPGDAILSNTEKIN 48 >U58760-3|AAL02443.1| 53|Caenorhabditis elegans Ribosomal protein, large subunitprotein 22, isoform b protein. Length = 53 Score = 27.1 bits (57), Expect = 8.9 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 139 NLKFTIDCTHPAEDSILDV 195 +LKF ++C +P ED IL + Sbjct: 20 HLKFNVECKNPVEDGILRI 38 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,305,514 Number of Sequences: 27780 Number of extensions: 186672 Number of successful extensions: 525 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 525 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -