BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0899 (667 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY089564-1|AAL90302.1| 422|Drosophila melanogaster RE03692p pro... 32 0.61 AE014296-2966|AAF49301.2| 422|Drosophila melanogaster CG5582-PA... 32 0.61 >AY089564-1|AAL90302.1| 422|Drosophila melanogaster RE03692p protein. Length = 422 Score = 32.3 bits (70), Expect = 0.61 Identities = 18/35 (51%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -2 Query: 216 EAPLVGILAKFIYIFYLFKNTLTLSLVLFI--FVN 118 E PLVG K YI +LFK L L LV F F+N Sbjct: 241 EKPLVGFKEKLFYIKHLFKYMLPLCLVYFFEYFIN 275 >AE014296-2966|AAF49301.2| 422|Drosophila melanogaster CG5582-PA protein. Length = 422 Score = 32.3 bits (70), Expect = 0.61 Identities = 18/35 (51%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -2 Query: 216 EAPLVGILAKFIYIFYLFKNTLTLSLVLFI--FVN 118 E PLVG K YI +LFK L L LV F F+N Sbjct: 241 EKPLVGFKEKLFYIKHLFKYMLPLCLVYFFEYFIN 275 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,229,787 Number of Sequences: 53049 Number of extensions: 366038 Number of successful extensions: 669 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2868730650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -