BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0898 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0847 + 32411521-32411619,32411737-32411851,32412292-324123... 31 0.66 01_05_0290 - 20487105-20487113,20487171-20487213,20488336-204884... 29 3.5 >01_06_0847 + 32411521-32411619,32411737-32411851,32412292-32412375, 32412430-32413478,32414690-32416371,32416477-32416586, 32417634-32418430,32418839-32418951,32419147-32419194, 32419425-32419652,32419732-32419829,32419967-32420019 Length = 1491 Score = 31.5 bits (68), Expect = 0.66 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = -2 Query: 599 GLKNQLMSTIRFPHTNLTSHKCQRYIISFKTHDFTFNSIMCTEVKNTLHNYVKLTPAV*E 420 G K + + + T+ S K +R + K HD T N I+C++ ++ + + P V E Sbjct: 613 GDKKRKRTKMSLKSTDCLSSKHKRLHLEMKAHDSTSNGILCSDDRSRVQQGSSIMPVVNE 672 >01_05_0290 - 20487105-20487113,20487171-20487213,20488336-20488412, 20489096-20489163,20489266-20489456,20490687-20490798, 20490892-20490943,20491984-20492076,20493065-20493211, 20493381-20493410,20493764-20493862,20495188-20495322, 20495420-20495498,20495989-20496064,20496345-20496423, 20496513-20496547,20497185-20497259,20497405-20497804 Length = 599 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -2 Query: 644 GDYWIGPATTSDFSIGLKNQLMSTIRFPHTNLTSHK 537 GDY + + G +N+L RF H+N TSHK Sbjct: 119 GDYVVAQRNPDADAPGGRNRLRINPRFLHSNATSHK 154 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,065,698 Number of Sequences: 37544 Number of extensions: 313014 Number of successful extensions: 476 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -