BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0896 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pom... 27 2.0 SPAC16A10.03c |||zinc finger protein Pep5/Vps11 |Schizosaccharom... 27 3.4 >SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1375 Score = 27.5 bits (58), Expect = 2.0 Identities = 21/61 (34%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = -1 Query: 203 YLLFLYEHLVQVNENHVA*FLTSKLISLRKSFYNT-SFLWISFLWSRW-PPKRLCPQKMC 30 YL LYEH+V E+H + +I ++ F T L+ SF W CP MC Sbjct: 1074 YLTNLYEHIVLKAESHQICIICRDII--KQGFITTCGHLYCSFCLEAWLKHSSSCP--MC 1129 Query: 29 K 27 K Sbjct: 1130 K 1130 >SPAC16A10.03c |||zinc finger protein Pep5/Vps11 |Schizosaccharomyces pombe|chr 1|||Manual Length = 860 Score = 26.6 bits (56), Expect = 3.4 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 80 KISTEKMYYKNSCVKKLTLRLEIKQHDFHLLVLNAHIKTINIHFY 214 KI + + K SC+ K T R+ I D +++LN+ ++ I FY Sbjct: 34 KILHDSVGNKISCIGKSTKRIAIGTLDGRIVILNSRLQLIR-DFY 77 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,007,006 Number of Sequences: 5004 Number of extensions: 62280 Number of successful extensions: 144 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -