BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0896 (698 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 24 1.2 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 22 6.4 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 22 6.4 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 22 6.4 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 22 6.4 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 50 VFSVAIGTTGKISTEKMYYKNSCVKKLTLRLEIKQHD 160 V SV IG + T + YKN + LT LEIK ++ Sbjct: 72 VDSVKIGESQGSVTLRQEYKNIKLYGLTKNLEIKNYN 108 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = -2 Query: 673 FWMGRLNIQKNLSLWNCYKTKGIM 602 FW+ + L +W Y T+G + Sbjct: 180 FWVTPFTVLPLLKVWGRYTTEGFL 203 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +1 Query: 118 RKEINFEVRNQAT*FSFTCTKCSY 189 + + + +RN F C KCSY Sbjct: 1 KHHLEYHLRNHFGSKPFKCEKCSY 24 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -1 Query: 377 FLTVGITK*WPFRRLIFCCFDSSASE 300 +L V +K W R CC +S E Sbjct: 60 YLQVSGSKIWQMERSCMCCQESGERE 85 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/24 (29%), Positives = 12/24 (50%) Frame = -2 Query: 673 FWMGRLNIQKNLSLWNCYKTKGIM 602 FW+ + L +W Y T+G + Sbjct: 180 FWVTPFTVLPLLKVWGRYTTEGFL 203 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,467 Number of Sequences: 438 Number of extensions: 4596 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -