BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0894 (689 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB24D3.08c |||NADP-dependent oxidoreductase |Schizosaccharomy... 56 4e-09 >SPAPB24D3.08c |||NADP-dependent oxidoreductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 349 Score = 56.4 bits (130), Expect = 4e-09 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 2/69 (2%) Frame = +3 Query: 3 LRTVYLSLDPYMRGRMSD--EPSYSPPVDIGGVMVGGTVSRVVESNHPDYQSGDWVLGYS 176 L+ +Y S+DPY+R RM SY PP+++G TV++VV+S Y+ G V+ S Sbjct: 48 LKNIYTSVDPYLRMRMQSPKHASYIPPLELGKPFYNSTVAKVVKSTLDQYKPGMDVVFVS 107 Query: 177 GWQDYDISS 203 GW++Y S Sbjct: 108 GWEEYTFVS 116 Score = 37.1 bits (82), Expect = 0.002 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +2 Query: 254 VGVLGMPGFTAYMGLLDIGQPKEGE 328 VG LGMP TAY GL IG+PK GE Sbjct: 138 VGSLGMPSQTAYCGLKHIGKPKAGE 162 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,968,397 Number of Sequences: 5004 Number of extensions: 62164 Number of successful extensions: 137 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -