BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0894 (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 24 1.6 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 24 1.6 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 3.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.3 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 21 8.4 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -2 Query: 679 RCSSVPYVAGSSFSDPARGSVALGEP 602 R +S P + SS S PA+G+ A G+P Sbjct: 516 RIASAPSSSTSS-SPPAKGAAAAGQP 540 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.8 bits (49), Expect = 1.6 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +1 Query: 184 KTMTYPVVMIW*NLAIIRKIHRGRGCARDAR-LYRLYGPT 300 K T V+M L + +IHRG G DAR L+R T Sbjct: 241 KLGTKQVLMASGELELTLRIHRGGGTNTDARHLFRTASST 280 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = -1 Query: 263 AHPRPRWILRMIAKFHQIITTGYVIVLPSTVAQHPVARLIIRMI 132 AHPR + + + Q + G V++ A P+A +++ I Sbjct: 298 AHPREEFNHWTVMRCVQAMIAGIVVISAGADAYPPLAAIVLGAI 341 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -2 Query: 424 EASFFLLPFDLHVLDLPHRRPHWSCRRSYHQRFALFRLT 308 E++ FL ++LH L+L + + ++ F L RLT Sbjct: 375 ESNAFLPLYNLHTLELSDNKLRTVGAQLFNGLFVLNRLT 413 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +3 Query: 102 GGTVSRVVESNHPDYQSGDWVLGYSGWQ 185 G T V++ N P + + LG WQ Sbjct: 219 GYTAPEVIKQNRPTPAADIYSLGIVAWQ 246 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,039 Number of Sequences: 438 Number of extensions: 5065 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -