Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0893
         (669 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY645022-1|AAT92558.1|  165|Anopheles gambiae hairy protein.           31   0.043
AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr...    23   6.6  
AJ459962-1|CAD31061.1|  685|Anopheles gambiae prophenoloxidase 9...    23   6.6  
EF426244-1|ABO26487.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426243-1|ABO26486.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426242-1|ABO26485.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426241-1|ABO26484.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426239-1|ABO26482.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426238-1|ABO26481.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426237-1|ABO26480.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426236-1|ABO26479.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426235-1|ABO26478.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426234-1|ABO26477.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426233-1|ABO26476.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426232-1|ABO26475.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426231-1|ABO26474.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426230-1|ABO26473.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426229-1|ABO26472.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426228-1|ABO26471.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426227-1|ABO26470.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426226-1|ABO26469.1|   64|Anopheles gambiae unknown protein.         23   8.7  
EF426225-1|ABO26468.1|   64|Anopheles gambiae unknown protein.         23   8.7  
DQ974165-1|ABJ52805.1|  482|Anopheles gambiae serpin 5 protein.        23   8.7  
AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.         23   8.7  

>AY645022-1|AAT92558.1|  165|Anopheles gambiae hairy protein.
          Length = 165

 Score = 30.7 bits (66), Expect = 0.043
 Identities = 16/57 (28%), Positives = 24/57 (42%)
 Frame = +3

Query: 402 TAVTMLHPSNPVPPILLPGDKPAQTNTYIPSNPPPANHRYTIIPDRHPTSTTIPVRP 572
           T  T +HPS P  P+L+P      +     S    ++  Y  +P  H TS+     P
Sbjct: 20  TLTTQVHPSQPPVPMLVPIPSRTASTGSASSGHSGSSSLYDRVPREHATSSPYHAPP 76


>AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase
           protein.
          Length = 1253

 Score = 23.4 bits (48), Expect = 6.6
 Identities = 7/17 (41%), Positives = 10/17 (58%)
 Frame = -2

Query: 530 DYCVSVVGWWWIGWYIS 480
           DY V+   W W+ W +S
Sbjct: 111 DYVVNEFSWLWLLWLLS 127


>AJ459962-1|CAD31061.1|  685|Anopheles gambiae prophenoloxidase 9
           protein.
          Length = 685

 Score = 23.4 bits (48), Expect = 6.6
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = +2

Query: 362 ATGTGHNENCRSSH 403
           +TG   NENC  SH
Sbjct: 614 STGFNENENCNDSH 627


>EF426244-1|ABO26487.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426243-1|ABO26486.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426242-1|ABO26485.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426241-1|ABO26484.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426239-1|ABO26482.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426238-1|ABO26481.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426237-1|ABO26480.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426236-1|ABO26479.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426235-1|ABO26478.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426234-1|ABO26477.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426233-1|ABO26476.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426232-1|ABO26475.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426231-1|ABO26474.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426230-1|ABO26473.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426229-1|ABO26472.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426228-1|ABO26471.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426227-1|ABO26470.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426226-1|ABO26469.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>EF426225-1|ABO26468.1|   64|Anopheles gambiae unknown protein.
          Length = 64

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 4/8 (50%), Positives = 7/8 (87%)
 Frame = -2

Query: 506 WWWIGWYI 483
           WWW+ W++
Sbjct: 26  WWWVLWHL 33


>DQ974165-1|ABJ52805.1|  482|Anopheles gambiae serpin 5 protein.
          Length = 482

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = -3

Query: 178 PEVLALELAFPFAISLYKHYLLLTND 101
           PE+ A  +AFP+       Y++L ND
Sbjct: 307 PELQARIMAFPYRNRTTSMYIVLPND 332


>AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.
          Length = 2259

 Score = 23.0 bits (47), Expect = 8.7
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -2

Query: 572 WTDGNCCTGWVAVRDY 525
           WTDGN  T  +  RDY
Sbjct: 6   WTDGNIHTTALTPRDY 21


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 708,810
Number of Sequences: 2352
Number of extensions: 14384
Number of successful extensions: 45
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 45
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 66904800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)