BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0891 (692 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1340 + 36424426-36424542,36425212-36425283,36425383-364254... 28 6.1 >01_06_1340 + 36424426-36424542,36425212-36425283,36425383-36425486, 36425567-36425669,36425757-36425918,36426043-36426320, 36429428-36429578,36429795-36429959,36430077-36430154, 36430284-36430373,36430460-36430546,36430636-36430722, 36430779-36430890,36431033-36431136,36431435-36431510, 36431954-36432104,36432246-36432314,36432408-36432474, 36433060-36433089 Length = 700 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/63 (22%), Positives = 29/63 (46%) Frame = -1 Query: 410 IMSMGSRNHITQGGL*TSPTI*NLSNKKNCPTILTKGFKV*YIIFICP*HKEFTKIEXQA 231 ++S G ++ + +GG+ ++ K P ++ GF + II + K T +A Sbjct: 244 LISFGEKSRVGRGGMQAKVAAAFTASSKGIPVVIASGFAIDSIIKVMRGEKIGTLFHREA 303 Query: 230 LKW 222 +W Sbjct: 304 NQW 306 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,452,903 Number of Sequences: 37544 Number of extensions: 334186 Number of successful extensions: 533 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -