BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0890 (691 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 2.4 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 22 4.1 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 7.2 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -2 Query: 588 FQNWNKSPAGTPS 550 F W KSP G PS Sbjct: 64 FHPWKKSPQGAPS 76 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 650 CTESANSRNPVACSTFRPFPSFKTGINPLLAR 555 CT++ R+P CS F ++ G PL R Sbjct: 422 CTKAGYVRDPDDCSIFYYCLAYNGGFVPLEQR 453 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -1 Query: 475 FWNNTTRFFVGVGTYRSMKAGLPNEDAP 392 FW++ + F GT+ +P ED P Sbjct: 176 FWHSHSGFQRSDGTFGPFIVRVPEEDNP 203 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,636 Number of Sequences: 336 Number of extensions: 3702 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -