BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0890 (691 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.3 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 22 6.3 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 8.4 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 8.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 8.4 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 8.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 8.4 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 8.4 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 6.3 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 12 LSIPPTPLGIRLSKTRAQETNPADVTLFIQLKRHR 116 L+ PPTPL I + +R E + D T + R R Sbjct: 1394 LTSPPTPLSISRAGSR-DEDSTRDSTKLDRSSRER 1427 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.8 bits (44), Expect = 6.3 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -2 Query: 636 QFQKSGGLLNLSAIPF 589 ++ +SGGL+N+ P+ Sbjct: 204 KYHRSGGLMNVERFPY 219 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 94 VYYGNFPPRPIMVRPWVPMRGQ 115 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 94 VYYGNFPPRPIMVRPWVPMRGQ 115 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 94 VYYGNFPPRPIMVRPWVPMRGQ 115 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 94 VYYGNFPPRPIMVRPWVPMRGQ 115 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 94 VYYGNFPPRPIMVRPWVPMRGQ 115 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 94 VYYGNFPPRPIMVRPWVPMRGQ 115 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 94 VYYGNFPPRPIMVRPWVPMRGQ 115 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 343 VYYGNFPPRPIMVRPWVPMRGQ 364 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 343 VYYGNFPPRPIMVRPWVPMRGQ 364 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 343 VYYGNFPPRPIMVRPWVPMRGQ 364 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 343 VYYGNFPPRPIMVRPWVPMRGQ 364 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 343 VYYGNFPPRPIMVRPWVPMRGQ 364 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 343 VYYGNFPPRPIMVRPWVPMRGQ 364 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 342 VYYGNFPPRPIMVRPWVPMRGQ 363 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 327 VYYGNFPPRPIMVRPWVPMRGQ 348 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 Query: 92 VHSAQAPPAGR*IRSWPPLRGR 157 V+ PP +R W P+RG+ Sbjct: 343 VYYGNFPPRPIMVRPWVPMRGQ 364 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 568 PCWHAV 551 PCWHAV Sbjct: 1465 PCWHAV 1470 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +3 Query: 357 LAMRNGSAS*TPGASSLGKPAF 422 L ++NG PG + +G+P++ Sbjct: 204 LGVQNGYGRHLPGHAQMGRPSY 225 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,257 Number of Sequences: 438 Number of extensions: 4694 Number of successful extensions: 29 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -