BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0889 (693 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 24 1.4 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.5 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 22 5.5 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 22 5.5 AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esteras... 22 5.5 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 200 LLDSKFKNIVTTIYLNNVLF 259 LLD K I+ T +LNN F Sbjct: 280 LLDEKLSYIILTSFLNNFYF 299 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -1 Query: 597 LFFCSMYFFFSYVFVPIVILAYGDICYIFR*GRNYYITQFLKISI 463 L FC + FF+ + ++ L Y + +F Y+ + F+ +I Sbjct: 180 LLFCCAFIFFNMHLLFLLCLDYFTLHLLFLPCIYYFYSAFIIFTI 224 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -1 Query: 384 IEEIPERKQRFRQYTNFKIHQINFLCIKK 298 + E+ +R + F+ T+F++ NFL +++ Sbjct: 322 LSEVLQRPKPFKPITDFELAVPNFLKLQR 350 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -1 Query: 384 IEEIPERKQRFRQYTNFKIHQINFLCIKK 298 + E+ +R + F+ T+F++ NFL +++ Sbjct: 322 LSEVLQRPKPFKPITDFELAVPNFLKLQR 350 >AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esterase protein. Length = 509 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -1 Query: 384 IEEIPERKQRFRQYTNFKIHQINFLCIKK 298 + E+ +R + F+ T+F++ NFL +++ Sbjct: 321 LSEVLQRPKPFKPITDFELAVPNFLKLQR 349 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,174 Number of Sequences: 336 Number of extensions: 3528 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -