BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0889 (693 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 25 1.7 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.2 EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. 23 6.9 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 6.9 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 23 6.9 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 25.4 bits (53), Expect = 1.7 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 548 MGTKT*EKKKYMLQKN-NHFLFYTFSSKYRL 637 +G + + Y + N NH +FYT S+YRL Sbjct: 2460 LGRSAGDVQSYEIDANGNHRMFYTGFSRYRL 2490 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 5.2 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 548 MGTKT*EKKKYMLQKN-NHFLFYTFSSKYRL 637 +G + + Y + N NH FYT S+YRL Sbjct: 2450 LGRSAGDVQSYEIDANGNHRKFYTGFSRYRL 2480 >EF519525-1|ABP73588.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 23.4 bits (48), Expect = 6.9 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = -1 Query: 225 IFLNLESNKMADISKWPIFQ---NADLHINRL 139 I L L NK+ + + P+F+ DL NR+ Sbjct: 182 ILLKLPHNKLTSVDEVPVFEKLITLDLSFNRI 213 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 23.4 bits (48), Expect = 6.9 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 396 LTHQIEEIPERKQRFRQYTNFKIHQINFLCIKKTKGK 286 L +I+E+ ER Y N K + LC+K+T K Sbjct: 325 LQQEIDEMMERYNGEITYENIKEMKYLDLCVKETLRK 361 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.4 bits (48), Expect = 6.9 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -1 Query: 396 LTHQIEEIPERKQRFRQYTNFKIHQINFLCIKKTKGK 286 L +I+E+ ER Y N K + LC+K+T K Sbjct: 325 LQQEIDEMMERYNGEITYENIKEMKYLDLCVKETLRK 361 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 684,381 Number of Sequences: 2352 Number of extensions: 12266 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -