BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0888 (688 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g27440.1 68417.m03944 protochlorophyllide reductase B, chloro... 27 8.8 >At4g27440.1 68417.m03944 protochlorophyllide reductase B, chloroplast / PCR B / NADPH-protochlorophyllide oxidoreductase B (PORB) identical to SP:P21218 protochlorophyllide reductase B, chloroplast precursor (EC 1.3.1.33) (PCR B) (NADPH-protochlorophyllide oxidoreductase B) (POR B) [Arabidopsis thaliana] Length = 401 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 587 VVIC*FCFIYFPFLKWPPYYPNGFLKSIFENH 682 V++C +YFP K P Y GF S+ NH Sbjct: 169 VLVC-NAAVYFPTAKEPTYSAEGFELSVATNH 199 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,992,134 Number of Sequences: 28952 Number of extensions: 230914 Number of successful extensions: 407 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 407 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -