BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0885 (673 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_01_0052 - 867152-867255,867322-867433,868996-869066,869526-86... 30 1.9 02_05_0793 - 31782203-31782355,31782958-31783096,31783407-317837... 30 1.9 12_01_0032 - 266954-267079,267204-267245,267290-267366,267450-26... 28 5.9 02_01_0312 - 2082614-2082677,2082815-2082945,2083041-2083129,208... 28 5.9 01_06_0091 - 26363070-26363361,26363467-26363625,26363708-263638... 28 5.9 >09_01_0052 - 867152-867255,867322-867433,868996-869066,869526-869623, 869988-870060,872280-872670 Length = 282 Score = 29.9 bits (64), Expect = 1.9 Identities = 21/66 (31%), Positives = 31/66 (46%) Frame = +3 Query: 105 LTAHSGHIG*AVKFRTNTYLVVIFHHETLDACPPESSALTSSKIRKKPRSYQWRPISGDT 284 LTAHSG A + Y F +TLD ++ + S I K R +R ++ D Sbjct: 96 LTAHSGTHVDAPGHVFDHYYHAGFDVDTLDLAILNANVMESLHIPKGVRRVLFRTLNTDR 155 Query: 285 KLIWPR 302 KL+W + Sbjct: 156 KLMWKK 161 >02_05_0793 - 31782203-31782355,31782958-31783096,31783407-31783710, 31783820-31783983,31784105-31784327,31784697-31784937, 31786053-31786182,31786272-31786900 Length = 660 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +3 Query: 210 SSALTSSKIRKKPRSYQWRPISGDT-KLIWPRIDGMDFTSMWFQHDRATCHTKREA 374 SS T +R K +WR I L W + D T +W + ++ C++ R++ Sbjct: 355 SSLNTHRALRDKENQKKWRTIRDFADSLCWEMLSQQDETIVWKKTNKLDCYSSRKS 410 >12_01_0032 - 266954-267079,267204-267245,267290-267366,267450-267540, 267864-267924,268021-268079,268176-268266,268481-268698, 268818-268824,269013-269148,270064-270307 Length = 383 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 Query: 198 CPPESSALTSSKIRKKP 248 C P+SSA+T SK +KKP Sbjct: 139 CAPDSSAVTLSKTKKKP 155 >02_01_0312 - 2082614-2082677,2082815-2082945,2083041-2083129, 2083223-2083292,2083429-2083509,2083768-2083821, 2084864-2085067,2086272-2086366,2086976-2086997, 2087492-2087585,2087677-2087764,2087874-2087979, 2088103-2088189,2088261-2088309,2088418-2088521, 2088605-2088697,2088900-2088974,2089316-2089384, 2090182-2090250,2090339-2090374,2090471-2090565, 2090836-2090911,2091067-2091153,2091287-2091355, 2091654-2091731,2091836-2091925,2092436-2092642, 2092736-2092879 Length = 841 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/27 (40%), Positives = 21/27 (77%) Frame = -3 Query: 482 ESRAVLNHTISRAFEFLISDVVIKNYK 402 E AVL+H++S +F+FL++ +V +Y+ Sbjct: 28 ELPAVLSHSLSSSFDFLLAPLVDPDYR 54 >01_06_0091 - 26363070-26363361,26363467-26363625,26363708-26363880, 26366639-26366810,26366912-26367294 Length = 392 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 255 YQWRPISGDTKLIWPRIDGMDFTSMW 332 Y+WRP S + PR +G+DF S W Sbjct: 117 YRWRPSSCEL----PRFNGLDFLSKW 138 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,336,153 Number of Sequences: 37544 Number of extensions: 331638 Number of successful extensions: 695 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -