BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0884 (689 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0373 + 28374298-28374380,28375126-28375303,28375975-283760... 30 2.0 >02_05_0373 + 28374298-28374380,28375126-28375303,28375975-28376065, 28376162-28376256,28376379-28376468,28376789-28376837, 28376941-28377079,28377224-28377340,28377437-28377527, 28377604-28377746,28378009-28378123,28378439-28378483, 28378565-28378645 Length = 438 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = -2 Query: 616 IYTNVSTIHILLSISRQHRN*CAFKFVHDFILILECY 506 +Y +S ++I++ +S CAFKFV + + + + Y Sbjct: 59 LYMRISNVYIVIVVSSNANVACAFKFVVEAVALFKSY 95 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,328,814 Number of Sequences: 37544 Number of extensions: 244252 Number of successful extensions: 324 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 324 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -