BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0884 (689 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34900| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-12) 29 3.6 SB_10640| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_34900| Best HMM Match : 7tm_1 (HMM E-Value=2.5e-12) Length = 433 Score = 29.1 bits (62), Expect = 3.6 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +2 Query: 386 IYNLIQLVFYISILNVWNVSSLN 454 + N + L FY++IL +WN S++N Sbjct: 381 VTNTLFLTFYVTILVMWNTSTMN 403 >SB_10640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -1 Query: 452 LVMTHSTHLV*KYKTPTESDYKLCF*RFSLTINAASSSANRLQVRFYKNLKC 297 L++ HS HLV + P ES++ L I +++ L V Y + KC Sbjct: 959 LIVLHSPHLVPQLVQPNESEFALSLLSLGNGIGGLAAAIVGLFVEPYLSAKC 1010 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,798,358 Number of Sequences: 59808 Number of extensions: 322745 Number of successful extensions: 582 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 582 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -