Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0883
         (696 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC13E7.06 |msd1|mug172|spindle pole body protein Msd1|Schizosa...    28   1.5  
SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transpo...    25   7.8  

>SPBC13E7.06 |msd1|mug172|spindle pole body protein
           Msd1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 331

 Score = 27.9 bits (59), Expect = 1.5
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 12/82 (14%)
 Frame = +1

Query: 382 CTFGTLEVFVNVVFDLFLRANYP----------LMHSKITKYTIFFKT--HEPRYLS*DS 525
           C  GTL   V ++  L+ R N            L+ +KI    +F +   HE +Y+S D 
Sbjct: 236 CLSGTLNSLVEMLSPLYERPNSNPFEVCELNAILLDAKIQNQLLFIRNLLHERKYVSIDE 295

Query: 526 IDALYFYKLIMVLKKNPKTKHV 591
           +DA        +L++N K KH+
Sbjct: 296 LDA--------ILEENEKNKHL 309


>SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transporter
            Bfr1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1530

 Score = 25.4 bits (53), Expect = 7.8
 Identities = 6/14 (42%), Positives = 10/14 (71%)
 Frame = +2

Query: 59   CWYLPVRXYKRSYH 100
            CW+ P++ YK  +H
Sbjct: 1318 CWFYPIKFYKHIHH 1331


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,672,994
Number of Sequences: 5004
Number of extensions: 51450
Number of successful extensions: 77
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 73
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 77
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 321151040
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)