BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0883 (696 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00035-8|ABL01530.1| 96|Caenorhabditis elegans Hypothetical pr... 28 5.5 AF016447-10|AAG24008.1| 314|Caenorhabditis elegans Hypothetical... 28 7.3 >U00035-8|ABL01530.1| 96|Caenorhabditis elegans Hypothetical protein R01H2.8 protein. Length = 96 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 301 ASDCTTAYFLLINLILVKLAVIGAFMLSCRLP 206 A + T FL++ + LAVIGA ++ C P Sbjct: 22 AENLVTLIFLIVIFTIFALAVIGAILIGCLKP 53 >AF016447-10|AAG24008.1| 314|Caenorhabditis elegans Hypothetical protein C54F6.3 protein. Length = 314 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 406 FVNVVFDLFLRANYPLMHSKITK 474 FVN+V D F+ +NY LM I K Sbjct: 52 FVNIVSDFFVASNYKLMSCGIRK 74 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,740,203 Number of Sequences: 27780 Number of extensions: 284656 Number of successful extensions: 395 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -